PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.043300.3
Common NameCsa_6G504650, LOC101207689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 236aa    MW: 25033.7 Da    PI: 7.7784
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.043300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.72.5e-7191653154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa........aeaaskrkrelkskkqsalsst 89 
                      g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaakrrerq++laa+++++ +++         ++++kr+r     ++s+l++t
  Cucsa.043300.3   9 GGGISCQDCGNQAKKDCSHMRCRTCCKSRGFHCETHVKSTWVPAAKRRERQDKLAALQTHHHHHHqqqlqlhgGDNNPKRHR---DYNSSSLACT 100
                     5789****************************************************99988877767777544444444444...569999**** PP

          DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      ++++++++ le+ ++P+e++s+avfrcvrvss dd ++++aYqtav+igGhvfkGiLydqG+e+
  Cucsa.043300.3 101 LIPTNNNTSGLEIGNFPAELNSPAVFRCVRVSSADDTDDQYAYQTAVNIGGHVFKGILYDQGPEN 165
                     ***************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.2E-6711164IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.8E-281355IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.4E-27116163IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MMISSGSGGG GISCQDCGNQ AKKDCSHMRC RTCCKSRGFH CETHVKSTWV PAAKRRERQD  60
KLAALQTHHH HHHQQQLQLH GGDNNPKRHR DYNSSSLACT LIPTNNNTSG LEIGNFPAEL  120
NSPAVFRCVR VSSADDTDDQ YAYQTAVNIG GHVFKGILYD QGPENNYIPP GETSSGGGGS  180
SSGVQPLNFI AGAADATTGS GGSTAALPLL DPSSLYSTPL NSFMAGTQFF LPPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149998.11e-176PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9SD401e-80SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A0A0KGL41e-175A0A0A0KGL4_CUCSA; Uncharacterized protein
STRINGPOPTR_0007s13610.18e-86(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-72Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]